PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30156.m001710
Common NameLOC8276883, RCOM_1546390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 444aa    MW: 49717.5 Da    PI: 4.9196
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30156.m001710genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS289.87.6e-89474372373
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPilkfsh 95 
                    ++lLl+cA a++s+d +laq++++ l++ as  gdp+qRl++ f++AL +r ++ +++ ++   +s+ +     +++++++l  ++++ P+++f++
  30156.m001710  47 EKLLLHCASALESNDGTLAQQVMWVLNNVASLVGDPNQRLTSWFLRALISRASKVCPTAMNFDGSSTIQ----RRQMSVTELagYVDLIPWHRFGF 138
                    689***************************************************777777655444444....333344444459*********** PP

           GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl....... 181
                     + N+aI +a+e++ +vHi+Df+i++++QWp+L++aLa+RpegppslRiT+     ++    + ++ee+g rL +fA++ +vpfef v+       
  30156.m001710 139 CASNSAIFKAIEECPKVHILDFSITHCMQWPTLIDALAKRPEGPPSLRITVPFTRPQVppwLNVSTEEVGLRLGNFAKSRDVPFEFIVIddpssdi 234
                    **************************************************95553444599999******************************** PP

           GRAS 182 ..........vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                               ++ l+ l++++L+++ +Eal++n++  l +l +e+ + ++    rd++L+ +k l+P + v+v++++d++++++  r++ +++y 
  30156.m001710 235 lcketsagshFESLLNHLSPSALNLRDDEALVINCQNWLRYLSNEQKCRAQdssLRDTFLHSIKILNPCITVIVDEDSDLDAPDLTSRITTCFNYL 330
                    999999887555678889*************************999887766679***************************************** PP

           GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                    +  fd+le+ lp++s +ri +E   +g +i+n+++ eg++r+er e+  k  +r+++aGF +v++ e++  ++k+ll +++  g+ +++e++ lvl
  30156.m001710 331 WIPFDALETFLPTDSCQRIEYESD-IGHKIENIISYEGSQRTERLESGIKLTQRMKNAGFCSVEFCEETIREVKSLLDEHA-SGWGMKKEEDMLVL 424
                    ************************.********************************************************.889999******** PP

           GRAS 361 gWkdrpLvsvSaW 373
                    +Wk+++ v++SaW
  30156.m001710 425 TWKGHNSVFASAW 437
                    ************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.51120419IPR005202Transcription factor GRAS
PfamPF035142.6E-8647437IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MKTELRTNTS TPISLQNSTL FNSPQTQSSL SGALRGCLGS LDGACIEKLL LHCASALESN  60
DGTLAQQVMW VLNNVASLVG DPNQRLTSWF LRALISRASK VCPTAMNFDG SSTIQRRQMS  120
VTELAGYVDL IPWHRFGFCA SNSAIFKAIE ECPKVHILDF SITHCMQWPT LIDALAKRPE  180
GPPSLRITVP FTRPQVPPWL NVSTEEVGLR LGNFAKSRDV PFEFIVIDDP SSDILCKETS  240
AGSHFESLLN HLSPSALNLR DDEALVINCQ NWLRYLSNEQ KCRAQDSSLR DTFLHSIKIL  300
NPCITVIVDE DSDLDAPDLT SRITTCFNYL WIPFDALETF LPTDSCQRIE YESDIGHKIE  360
NIISYEGSQR TERLESGIKL TQRMKNAGFC SVEFCEETIR EVKSLLDEHA SGWGMKKEED  420
MLVLTWKGHN SVFASAWLPS CLED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-26444372374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515699.10.0PREDICTED: scarecrow-like protein 32
TrEMBLB9RPN00.0B9RPN0_RICCO; DELLA protein DWARF8, putative
STRINGPOPTR_0017s06900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-125GRAS family protein